PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_03795
Common NameKK1_003876
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 363aa    MW: 40955.8 Da    PI: 7.3526
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_03795genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
    C.cajan_03795 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.96.4e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
    C.cajan_03795  67 RGTFSQEEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466891.25E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.5E-151461IPR001005SANT/Myb domain
CDDcd001671.67E-111761No hitNo description
PROSITE profilePS5129425.94862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1366114IPR001005SANT/Myb domain
PfamPF002498.3E-1467111IPR001005SANT/Myb domain
CDDcd001672.80E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPVTHKPLS EVENGEDKEK AQEVSNELNL LKSESSNYAT TECLPNDSNS SHWFSQNGRP  180
FDMNSEIPFN AAATSIPTPT TNLFLPNNSF CYKPSLAVPS DNVSTPYGSH YWEATASNNS  240
NSSIRSDSST EMRTSSPLNL PYSWGLADCS TSTKEAQIHM MENHAEEAKW DEYLHNPISM  300
LASVQNQAPE SLCNEIKTSM HLVPDNTLGA MLPHSHTKQQ EPSQNSSIFS KDMQKLRAAF  360
GHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973261e-132BT097326.1 Soybean clone JCVI-FLGm-21J24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492385.11e-173PREDICTED: transcription factor MYB86
SwissprotQ8LPH66e-84MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A151SS830.0A0A151SS83_CAJCA; Transcription factor MYB86
STRINGGLYMA03G38410.11e-152(Glycine max)
STRINGGLYMA19G41010.21e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.18e-97myb domain protein 61